DPH4 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:LQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DNAJC24
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for DPH4 Antibody
- CSL-type zinc finger-containing protein 3
- DnaJ (Hsp40) homolog, subfamily C, member 24
- dnaJ homolog subfamily C member 24
- DPH4 homolog
- DPH4, JJJ3 homolog (S. cerevisiae)
- DPH4, JJJ3 homolog
- DPH41700030A21Rik
- JJJ3
- S. cerevisiae)
- ZCSL3
- zinc finger, CSL domain containing 3
- zinc finger, CSL-type containing 3