Complexin-2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CPLX2 (complexin 2) The peptide sequence was selected from the N terminal of CPLX2.Peptide sequence MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CPLX2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CPLX2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Complexin-2 Antibody
- complexin 2
- Complexin II
- Complexin-2
- CPLX2
- CPX II
- CPX2
- CPX-2
- CPX-II
- DKFZp547D155
- Hfb1
- MGC138492
- Synaphin 1
- synaphin 1,921-L
- synaphin-1
Background
Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.