Product: Tetracycline (hydrochloride)
CPNE1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CPNE1
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 – 1:250
- Immunocytochemistry/Immunofluorescence 1-4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
| Control Peptide |
| CPNE1 Recombinant Protein Antigen (NBP2-54980PEP) |
|
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for CPNE1 Antibody
PMID: 1554696
Product: Exendin-5 (Acetate)
CPNE1 Antibody Summary
| Immunogen |
Recombinant protein encompassing a sequence within the center region of human Copine 1. The exact sequence is proprietary.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CPNE1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:3000
- Immunohistochemistry 10 – 1:500
- Immunohistochemistry-Paraffin 1:100-1:1000
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
0.1M Tris (pH 7.0), 0.1M Glycine and 10% Glycerol
|
| Preservative |
0.01% Thimerosal
|
| Concentration |
0.55 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CPNE1 Antibody
Background
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5 UTR. All variants encode the same protein.
PMID: 25740522