COPS6 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
COPS6
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
||
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for COPS6 Antibody
- BMP2B
- BMP2B1
- BMP4
- COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
- COP9 signalosome complex subunit 6
- CSN6COP9 subunit 6 (MOV34 homolog, 34 kD)
- H_NH0506M12.12
- HVIP
- JAB1-containing signalosome subunit 6
- MOFC11
- MOV34 homolog
- MOV34 homolog, 34 kD
- MOV34-34KD
- SGN6
- Signalosome subunit 6
- Vpr-interacting protein