Product: Gallamine Triethiodide
CD5L Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CD5L
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:250 – 1:500
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:1000 – 1:2500
|
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
| Control Peptide |
| CD5L Protein (NBP2-39094PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CD5L Antibody
PMID: 11306611
Product: Enalaprilat D7 (Sodium Salt)
CD5L Antibody Summary
| Immunogen |
Antibody was raised against a 13 amino acid synthetic peptide near the carboxy terminus of human AIM. The immunogen is located within amino acids 250 – 300 of AIM.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CD5L
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 0.5-1 ug/ml
- ELISA 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
| Application Notes |
This antibody can be used for the detection of AIM by Western blot at 0.5 – 1 mg/ml.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Control Peptide |
| CD5L Peptide (NBP1-76699PEP) |
|
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS
|
| Preservative |
0.02% Sodium Azide
|
| Concentration |
1 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CD5L Antibody
Background
Apoptosis inhibitor of macrophages (AIM) is a member of the scavenger receptor cysteine-rich domain superfamily (SRCR-SF) initially identified as an inducible cell surface ligand of CD5. It was shown that AIM functions in the thymus as the inducer of resistance to apoptosis within CD4+/CD8+ thymocytes and as the supporter of the viability of these cells before thymic selection. AIM was also shown to support macrophage survival and enhance their phagocytic function. More recent experiments using recombinant AIM significantly inhibited apoptosis of NKT and T cells obtained from C. parvum-stimulated livers in vitro, suggesting that AIM functions to induce resistance to apoptosis in these cells and supports host defense against inflammation during infection.
PMID: 1828860