C1QB Antibody Summary
| Immunogen |
Synthetic peptides corresponding to C1QB(complement component 1, q subcomponent, B chain) The peptide sequence was selected from the C terminal of C1QB.Peptide sequence AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD.
|
| Specificity |
This product is specific to Subunit or Isofrom: B.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
C1QB
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against C1QB and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for C1QB Antibody
- B chain
- complement C1q subcomponent subunit B
- complement component 1, q subcomponent, B chain
- complement subcomponent C1q chain B
- q subcomponent, beta polypeptide
Background
C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q.