AMPK alpha 2 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP.
|
| Specificity |
This product is specific to Subunit or Isofrom: alpha-2.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PRKAA2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PRKAA2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AMPK alpha 2 Antibody
- 5-AMP-activated protein kinase catalytic subunit alpha-2
- AMPK alpha 2
- AMPK subunit alpha-2
- AMPK2
- AMPK5-AMP-activated protein kinase, catalytic alpha-2 chain
- AMPK-alpha-2 chain
- EC 2.7.11
- EC 2.7.11.1
- PRKAA
- PRKAA2
- protein kinase, AMP-activated, alpha 2 catalytic subunit
Background
The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that