Product: SAR7334 (hydrochloride)
ALS2CR2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
STRADB
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100 – 1:250
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:20 – 1:50
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
| Control Peptide |
| ALS2CR2 Protein (NBP1-90184PEP) |
|
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ALS2CR2 Antibody
PMID: 18511926
Product: Lys02 (trihydrochloride)
ALS2CR2 Antibody Summary
| Immunogen |
Carrier-protein conjugated synthetic peptide encompassing a sequence within the C-terminus region of human ALS2CR2. The exact sequence is proprietary.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
STRADB
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:3000
- Immunocytochemistry/Immunofluorescence 1:100-1:1001
- Immunohistochemistry 10 – 1:500
- Immunohistochemistry-Paraffin 1:100-1:1000
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
0.1M Tris (pH 7.0), 0.1M Glycine and 10% Glycerol
|
| Preservative |
0.01% Thimerosal
|
| Concentration |
1.03 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ALS2CR2 Antibody
Background
This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. [provided by RefSeq]
PMID: 15821753
Product: EX-528 (S-enantiomer)
ALS2CR2 Antibody Summary
| Immunogen |
Synthetic peptide from human STRADB.
|
| Specificity |
synthetic peptide corresponding to amino acids near the center of human ILPIP
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
STRADB
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 10 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS
|
| Preservative |
0.02% Sodium Azide
|
| Concentration |
1.0 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ALS2CR2 Antibody
Background
ILPIP (ILP-interacting protein) has recently been shown to interact with XIAP, a member of the IAP (Inhibitor of Apoptosis) protein family. Together, these two proteins synergistically activate the TAK1/JNK1 signal transduction pathway, which acts to protect against the interleukin-1b converting enzyme of Fas-induced apotosis. This protein was independently isolated and characterized as polyploidy-associated protein kinase (PAPK), a member of the Ste20/germinal center kinase family that modulates cytoskeletal organization and cell survival, suggesting that its protective role may be a function of its kinase activity. Although two mRNA sequences have been isolated, only the shorter isoform has been observed.
PMID: 12676604